HPV45 E6

Accession: H000080

NC: ABP99808.1

Uniprot: P21735

Protein: E6

Organism: Human papillomavirus type 45

Function

It is an oncogenic protein which causes transformation of host cell by binding to p53 tumour suppressor protein. For binding, it requires E6-associated protein (E6-AP) which is involved in the ubiquitin ligase pathway. E6-AP binds ubiquitin to the p53 pro

Mutation

102-200

201-300

301-400

401-500

501-578

Legend:same sensemissenseinsertiondeletion

Mutation type	Position	DESC	Disease	Reference
same sense	134	C → T	Disease: Cervical carcinoma Region : Sichuan	Ref
missense	157	C → T (T → I)	Disease: Cervical carcinoma Region : Sichuan	Ref
missense	259	G → T (C → F)	hot spot Disease: Cervical carcinoma Region : Sichuan	Ref
same sense	341	T → C	Disease: Cervical carcinoma Region : Sichuan	Ref
same sense	482	T → C	hot spot Disease: Cervical carcinoma Region : Sichuan	Ref
same sense	497	A → G	Disease: Cervical carcinoma Region : Sichuan	Ref
same sense	549	C → A	Disease: Cervical carcinoma Region : Sichuan	Ref

show more details

Sequence&Mutation

         .         .         .         .         .         .　　　　　G:161
atggcgcgctttgacgatccaaagcaacgaccctacaagctaccagatttgtgcacagaa　　　　　C:60
 M  A  R  F  D  D  P  K  Q  R  P  Y  K  L  P  D  L  C  T  E 　　　　　P:20


         .         .         .         .         .         .　　　　　G:221
ttgaatacatcactacaagacgtatctattgcctgtgtatattgcaaagcaacattggaa　　　　　C:60
 L  N  T  S  L  Q  D  V  S  I  A  C  V  Y  C  K  A  T  L  E 　　　　　P:20


         .         .         .         .         .         .　　　　　G:281
cgcacagaggtatatcaatttgcttttaaagatttatgtatagtgtatagagactgtata　　　　　C:60
 R  T  E  V  Y  Q  F  A  F  K  D  L  C  I  V  Y  R  D  C  I 　　　　　P:20


         .         .         .         .         .         .　　　　　G:341
gcatatgctgcatgccataaatgtatagacttttattccagaattagagaattaagatat　　　　　C:60
 A  Y  A  A  C  H  K  C  I  D  F  Y  S  R  I  R  E  L  R  Y 　　　　　P:20


         .         .         .         .         .         .　　　　　G:401
tattcaaactctgtatatggagagacactggaaaaaataactaatacagagttgtataat　　　　　C:60
 Y  S  N  S  V  Y  G  E  T  L  E  K  I  T  N  T  E  L  Y  N 　　　　　P:20


         .         .         .         .         .         .　　　　　G:461
ttgttaataaggtgcctgcggtgccagaaaccattgaacccagcagaaaaacgtagacac　　　　　C:60
 L  L  I  R  C  L  R  C  Q  K  P  L  N  P  A  E  K  R  R  H 　　　　　P:20


         .         .         .         .         .         .　　　　　G:521
cttaaggacaaacgaagatttcacagcatagctggacagtaccgagggcagtgtaataca　　　　　C:60
 L  K  D  K  R  R  F  H  S  I  A  G  Q  Y  R  G  Q  C  N  T 　　　　　P:20


         .         .         .         .         .          　　　　　G:578
tgttgtgaccaggcacggcaagaaagacttcgcagacgtagggaaacacaagtatag   　　　　　C:57
 C  C  D  Q  A  R  Q  E  R  L  R  R  R  R  E  T  Q  V       　　　　　P:18

Legend:gene mutationamino acid mutation

Epitope&Mutation

Legend:mutationepitope

>H000080_E6
MARFDDPKQRPYKLPDLCTELNTSLQDVSIACVYCKATLERTEVYQFAFKDLCIVYRDCIAYAACHKCIDFYSRIRELRYYSNSVYGETLEKITNTELYNLLIRCLRCQKPLNPAEKRRHLKDKRRFHSIAGQYRGQCNTCCDQARQERLRRRRETQV
············KLPDLCTEL(A*0201)·································································································································
··································································KCIDFYSRI(A*0201)···········································································
···································································································NLLIRCLRC(A*0201)··········································

DETAIL

EPITOPE & MUTATION