HPV18 E6

Accession: H000070

NC: NP_040310.1

Uniprot: P06463

Protein: E6

Organism: Human papillomavirus type 18

Function

It is an oncogenic protein which causes transformation of host cell by binding to p53 tumour suppressor protein. For binding, it requires E6-associated protein (E6-AP) which is involved in the ubiquitin ligase pathway. E6-AP binds ubiquitin to the p53 pro

Mutation

105-200

201-300

301-400

401-500

501-581

Legend:same sensemissenseinsertiondeletion

Mutation type	Position	DESC	Disease	Reference
same sense	218	A → T	Disease: Cervical carcinoma Region : Southwest China	Ref
same sense	485	T → C	Disease: Cervical carcinoma Region : Southwest China, Sichuan	Ref
same sense	549	C → A	Disease: Cervical carcinoma Region : Southwest China, Sichuan	Ref

show more details

Sequence&Mutation

         .         .         .         .         .         .　　　　　G:164
atggcgcgctttgaggatccaacacggcgaccctacaagctacctgatctgtgcacggaa　　　　　C:60
 M  A  R  F  E  D  P  T  R  R  P  Y  K  L  P  D  L  C  T  E 　　　　　P:20


         .         .         .         .         .         .　　　　　G:224
ctgaacacttcactgcaagacatagaaataacctgtgtatattgcaagacagtattggaa　　　　　C:60
 L  N  T  S  L  Q  D  I  E  I  T  C  V  Y  C  K  T  V  L  E 　　　　　P:20


         .         .         .         .         .         .　　　　　G:284
cttacagaggtatttgaatttgcatttaaagatttatttgtggtgtatagagacagtata　　　　　C:60
 L  T  E  V  F  E  F  A  F  K  D  L  F  V  V  Y  R  D  S  I 　　　　　P:20


         .         .         .         .         .         .　　　　　G:344
ccgcatgctgcatgccataaatgtatagatttttattctagaattagagaattaagacat　　　　　C:60
 P  H  A  A  C  H  K  C  I  D  F  Y  S  R  I  R  E  L  R  H 　　　　　P:20


         .         .         .         .         .         .　　　　　G:404
tattcagactctgtgtatggagacacattggaaaaactaactaacactgggttatacaat　　　　　C:60
 Y  S  D  S  V  Y  G  D  T  L  E  K  L  T  N  T  G  L  Y  N 　　　　　P:20


         .         .         .         .         .         .　　　　　G:464
ttattaataaggtgcctgcggtgccagaaaccgttgaatccagcagaaaaacttagacac　　　　　C:60
 L  L  I  R  C  L  R  C  Q  K  P  L  N  P  A  E  K  L  R  H 　　　　　P:20


         .         .         .         .         .         .　　　　　G:524
cttaatgaaaaacgacgatttcacaacatagctgggcactatagaggccagtgccattcg　　　　　C:60
 L  N  E  K  R  R  F  H  N  I  A  G  H  Y  R  G  Q  C  H  S 　　　　　P:20


         .         .         .         .         .          　　　　　G:581
tgctgcaaccgagcacgacaggaacgactccaacgacgcagagaaacacaagtataa   　　　　　C:57
 C  C  N  R  A  R  Q  E  R  L  Q  R  R  R  E  T  Q  V       　　　　　P:18

Legend:gene mutationamino acid mutation

Epitope&Mutation

Legend:mutationepitope

>H000070_E6
MARFEDPTRRPYKLPDLCTELNTSLQDIEITCVYCKTVLELTEVFEFAFKDLFVVYRDSIPHAACHKCIDFYSRIRELRHYSDSVYGDTLEKLTNTGLYNLLIRCLRCQKPLNPAEKLRHLNEKRRFHNIAGHYRGQCHSCCNRARQERLQRRRETQV
············KLPDLCTEL(A*0201)·································································································································
·······················SLQDIEITCV(A*0201)·····················································································································
························LQDIEITCV(A*0201)·····················································································································
··························DIEITCVYCKTVLEL(DR)·················································································································
···································KTVLELTE(A*0201)···········································································································
···································KTVLELTEV(A*0201)··········································································································
·······································ELTEVFEFA(A*0201)······································································································
··········································EVFEFAFKDLFVVYR(DRB1*15)····························································································
··············································FAFKDLFVV(A*0201)·······························································································
················································FKDLFVVYRDSIPHA(DR)···························································································
··················································DLFVVYRDSIPHAACHKCIDFY(DQ*0301)·············································································
···················································LFVVYRDSIPHAACH(DR*03 and DR*16)···········································································
···················································LFVVYRDSIP(DRB1*03)························································································
···················································LFVVYRDSIP(DRB1*16)························································································
··································································KCIDFYSRI(A*0201)···········································································
······································································FYSRIRELRHYSDSVYGDTLEK(DQ*0501)·························································
···························································································KLTNTGLYNL(A*0201)·················································
································································································GLYNLLIRCLRCQKP(DR*08 and DR*16)······························
···································································································NLLIRCLRC(A*0201)··········································
········································································································CLRCQKPLNPAEKLR(DR)···································

DETAIL

EPITOPE & MUTATION