HPV18 E6

Accession: H000070
NC: NP_040310.1
Uniprot: P06463
Protein: E6
Organism: Human papillomavirus type 18

Function

It is an oncogenic protein which causes transformation of host cell by binding to p53 tumour suppressor protein. For binding, it requires E6-associated protein (E6-AP) which is involved in the ubiquitin ligase pathway. E6-AP binds ubiquitin to the p53 pro

Mutation

105-200
201-300
301-400
401-500
501-581
Legend:same sensemissenseinsertiondeletion
show more details

Sequence&Mutation

         .         .         .         .         .         .     G:164
atggcgcgctttgaggatccaacacggcgaccctacaagctacctgatctgtgcacggaa     C:60
M A R F E D P T R R P Y K L P D L C T E      P:20


. . . . . .     G:224
ctgaacacttcactgcaagacatagaaataacctgtgtatattgcaagacagtattggaa     C:60
L N T S L Q D I E I T C V Y C K T V L E      P:20


. . . . . .     G:284
cttacagaggtatttgaatttgcatttaaagatttatttgtggtgtatagagacagtata     C:60
L T E V F E F A F K D L F V V Y R D S I      P:20


. . . . . .     G:344
ccgcatgctgcatgccataaatgtatagatttttattctagaattagagaattaagacat     C:60
P H A A C H K C I D F Y S R I R E L R H      P:20


. . . . . .     G:404
tattcagactctgtgtatggagacacattggaaaaactaactaacactgggttatacaat     C:60
Y S D S V Y G D T L E K L T N T G L Y N      P:20


. . . . . .     G:464
ttattaataaggtgcctgcggtgccagaaaccgttgaatccagcagaaaaacttagacac     C:60
L L I R C L R C Q K P L N P A E K L R H      P:20


. . . . . .     G:524
cttaatgaaaaacgacgatttcacaacatagctgggcactatagaggccagtgccattcg     C:60
L N E K R R F H N I A G H Y R G Q C H S      P:20


. . . . .      G:581
tgctgcaaccgagcacgacaggaacgactccaacgacgcagagaaacacaagtataa      C:57
C C N R A R Q E R L Q R R R E T Q V      P:18


Legend:gene mutationamino acid mutation

Epitope&Mutation

Legend:mutationepitope
>H000070_E6
MARFEDPTRRPYKLPDLCTELNTSLQDIEITCVYCKTVLELTEVFEFAFKDLFVVYRDSIPHAACHKCIDFYSRIRELRHYSDSVYGDTLEKLTNTGLYNLLIRCLRCQKPLNPAEKLRHLNEKRRFHNIAGHYRGQCHSCCNRARQERLQRRRETQV
············KLPDLCTEL(A*0201)·································································································································
·······················SLQDIEITCV(A*0201)·····················································································································
························LQDIEITCV(A*0201)·····················································································································
··························DIEITCVYCKTVLEL(DR)·················································································································
···································KTVLELTE(A*0201)···········································································································
···································KTVLELTEV(A*0201)··········································································································
·······································ELTEVFEFA(A*0201)······································································································
··········································EVFEFAFKDLFVVYR(DRB1*15)····························································································
··············································FAFKDLFVV(A*0201)·······························································································
················································FKDLFVVYRDSIPHA(DR)···························································································
··················································DLFVVYRDSIPHAACHKCIDFY(DQ*0301)·············································································
···················································LFVVYRDSIPHAACH(DR*03 and DR*16)···········································································
···················································LFVVYRDSIP(DRB1*03)························································································
···················································LFVVYRDSIP(DRB1*16)························································································
··································································KCIDFYSRI(A*0201)···········································································
······································································FYSRIRELRHYSDSVYGDTLEK(DQ*0501)·························································
···························································································KLTNTGLYNL(A*0201)·················································
································································································GLYNLLIRCLRCQKP(DR*08 and DR*16)······························
···································································································NLLIRCLRC(A*0201)··········································
········································································································CLRCQKPLNPAEKLR(DR)···································