HPV11 E6

Accession: H000068

NC: M14119.1

Uniprot: P04019

Protein: E6

Organism: Human papillomavirus type 11

Function

It is an oncogenic protein which causes transformation of host cell by binding to p53 tumour suppressor protein. For binding, it requires E6-associated protein (E6-AP) which is involved in the ubiquitin ligase pathway. E6-AP binds ubiquitin to the p53 pro

Mutation

102-200

201-300

301-400

401-500

501-554

Legend:same sensemissenseinsertiondeletion

Mutation type	Position	DESC	Disease	Reference
same sense	137	T → C	Disease: Condyloma acuminate Region : Sichuan	Ref
same sense	380	C → T	Disease: Condyloma acuminate Region : Sichuan	Ref
missense	466	G → A (G → E)	Disease: Condyloma acuminate Region : Sichuan	Ref
same sense	473	A → G	Disease: Condyloma acuminate Region : Sichuan	Ref

show more details

Sequence&Mutation

         .         .         .         .         .         .　　　　　G:161
atggaaagtaaagatgcctccacgtctgcaacatctatagaccagttgtgcaagacgttt　　　　　C:60
 M  E  S  K  D  A  S  T  S  A  T  S  I  D  Q  L  C  K  T  F 　　　　　P:20


         .         .         .         .         .         .　　　　　G:221
aatctttctttgcacactctgcaaattcagtgcgtgttttgcaggaatgcactgaccacc　　　　　C:60
 N  L  S  L  H  T  L  Q  I  Q  C  V  F  C  R  N  A  L  T  T 　　　　　P:20


         .         .         .         .         .         .　　　　　G:281
gcagagatatatgcatatgcctataagaacctaaaggttgtgtggcgagacaactttccc　　　　　C:60
 A  E  I  Y  A  Y  A  Y  K  N  L  K  V  V  W  R  D  N  F  P 　　　　　P:20


         .         .         .         .         .         .　　　　　G:341
tttgcagcgtgtgcctgttgcttagaactgcaagggaaaattaaccaatatagacacttt　　　　　C:60
 F  A  A  C  A  C  C  L  E  L  Q  G  K  I  N  Q  Y  R  H  F 　　　　　P:20


         .         .         .         .         .         .　　　　　G:401
aattatgctgcatatgcacctacagtagaagaagaaaccaatgaagatattttaaaagtg　　　　　C:60
 N  Y  A  A  Y  A  P  T  V  E  E  E  T  N  E  D  I  L  K  V 　　　　　P:20


         .         .         .         .         .         .　　　　　G:461
ttaattcgttgttacctgtgtcacaagccgttgtgtgaaatagaaaaactaaagcacata　　　　　C:60
 L  I  R  C  Y  L  C  H  K  P  L  C  E  I  E  K  L  K  H  I 　　　　　P:20


         .         .         .         .         .         .　　　　　G:521
ttgggaaaggcacgcttcataaaactaaataaccagtggaagggtcgttgcttacactgc　　　　　C:60
 L  G  K  A  R  F  I  K  L  N  N  Q  W  K  G  R  C  L  H  C 　　　　　P:20


         .         .         .                              　　　　　G:554
tggacaacatgcatggaagacttgttaccctaa                           　　　　　C:33
 W  T  T  C  M  E  D  L  L  P                               　　　　　P:10

Legend:gene mutationamino acid mutation

Epitope&Mutation

Legend:mutationepitope

>H000068_E6
MESKDASTSATSIDQLCKTFNLSLHTLQIQCVFCRNALTTAEIYAYAYKNLKVVWRDNFPFAACACCLELQGKINQYRHFNYAAYAPTVEEETNEDILKVLIRCYLCHKPLCEIEKLKHILGKARFIKLNNQWKGRCLHCWTTCMEDLLP
···········SIDQLCKTF(A*0201)··························································································································
··································································································KVLIRCYLC(A*0201)···································
··················································································································EKLKHILGKARFIKLN(DRB1*0102)·········

DETAIL

EPITOPE & MUTATION